PRSS12,BSSP-3,MRT1
  • PRSS12,BSSP-3,MRT1

Anti-PRSS12 Antibody 100ul

Ref: AN-HPA035055-100ul
Anti-PRSS12

Información del producto

Polyclonal Antibody against Human PRSS12, Gene description: protease, serine, 12 (neurotrypsin, motopsin), Alternative Gene Names: BSSP-3, MRT1, Validated applications: IHC, Uniprot ID: P56730, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PRSS12
Gene Description protease, serine, 12 (neurotrypsin, motopsin)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
Immunogen WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BSSP-3, MRT1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56730
HTS Code 3002150000
Gene ID 8492
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRSS12 Antibody 100ul

Anti-PRSS12 Antibody 100ul