HFM1,FLJ36760
  • HFM1,FLJ36760

Anti-HFM1 Antibody 100ul

Ref: AN-HPA035036-100ul
Anti-HFM1

Información del producto

Polyclonal Antibody against Human HFM1, Gene description: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae), Alternative Gene Names: FLJ36760, FLJ39011, MER3, SEC63D1, Validated applications: ICC, Uniprot ID: A2PYH4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HFM1
Gene Description HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
Immunogen SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ36760, FLJ39011, MER3, SEC63D1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A2PYH4
HTS Code 3002150000
Gene ID 164045
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HFM1 Antibody 100ul

Anti-HFM1 Antibody 100ul