PLCB1,KIAA0581
  • PLCB1,KIAA0581

Anti-PLCB1 Antibody 25ul

Ref: AN-HPA034743-25ul
Anti-PLCB1

Información del producto

Polyclonal Antibody against Human PLCB1, Gene description: phospholipase C, beta 1 (phosphoinositide-specific), Alternative Gene Names: KIAA0581, PLC-I, PLC154, Validated applications: IHC, WB, Uniprot ID: Q9NQ66, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLCB1
Gene Description phospholipase C, beta 1 (phosphoinositide-specific)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
Immunogen NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0581, PLC-I, PLC154
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQ66
HTS Code 3002150000
Gene ID 23236
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLCB1 Antibody 25ul

Anti-PLCB1 Antibody 25ul