METTL21A,FAM119A
  • METTL21A,FAM119A

Anti-METTL21A Antibody 25ul

Ref: AN-HPA034712-25ul
Anti-METTL21A

Información del producto

Polyclonal Antibody against Human METTL21A, Gene description: methyltransferase like 21A, Alternative Gene Names: FAM119A, HCA557b, HSPA-KMT, LOC151194, Validated applications: IHC, Uniprot ID: Q8WXB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name METTL21A
Gene Description methyltransferase like 21A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
Immunogen EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM119A, HCA557b, HSPA-KMT, LOC151194
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WXB1
HTS Code 3002150000
Gene ID 151194
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-METTL21A Antibody 25ul

Anti-METTL21A Antibody 25ul