TFAP2B,AP2-B
  • TFAP2B,AP2-B

Anti-TFAP2B Antibody 25ul

Ref: AN-HPA034683-25ul
Anti-TFAP2B

Información del producto

Polyclonal Antibody against Human TFAP2B, Gene description: transcription factor AP-2 beta (activating enhancer binding protein 2 beta), Alternative Gene Names: AP2-B, Validated applications: IHC, Uniprot ID: Q92481, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TFAP2B
Gene Description transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
Immunogen QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP2-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92481
HTS Code 3002150000
Gene ID 7021
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TFAP2B Antibody 25ul

Anti-TFAP2B Antibody 25ul