SYCP2L,C6orf177
  • SYCP2L,C6orf177

Anti-SYCP2L Antibody 25ul

Ref: AN-HPA034679-25ul
Anti-SYCP2L

Información del producto

Polyclonal Antibody against Human SYCP2L, Gene description: synaptonemal complex protein 2-like, Alternative Gene Names: C6orf177, dJ62D2.1, NO145, Validated applications: ICC, Uniprot ID: Q5T4T6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SYCP2L
Gene Description synaptonemal complex protein 2-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Immunogen TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf177, dJ62D2.1, NO145
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T4T6
HTS Code 3002150000
Gene ID 221711
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SYCP2L Antibody 25ul

Anti-SYCP2L Antibody 25ul