TNS2,C1-TEN
  • TNS2,C1-TEN

Anti-TNS2 Antibody 100ul

Ref: AN-HPA034659-100ul
Anti-TNS2

Información del producto

Polyclonal Antibody against Human TNS2, Gene description: tensin 2, Alternative Gene Names: C1-TEN, KIAA1075, TENC1, Validated applications: IHC, Uniprot ID: Q63HR2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNS2
Gene Description tensin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Immunogen VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1-TEN, KIAA1075, TENC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q63HR2
HTS Code 3002150000
Gene ID 23371
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNS2 Antibody 100ul

Anti-TNS2 Antibody 100ul