APLF,C2orf13
  • APLF,C2orf13

Anti-APLF Antibody 100ul

Ref: AN-HPA034643-100ul
Anti-APLF

Información del producto

Polyclonal Antibody against Human APLF, Gene description: aprataxin and PNKP like factor, Alternative Gene Names: C2orf13, MGC47799, Xip1, ZCCHH1, Validated applications: IHC, Uniprot ID: Q8IW19, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APLF
Gene Description aprataxin and PNKP like factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV
Immunogen NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf13, MGC47799, Xip1, ZCCHH1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IW19
HTS Code 3002150000
Gene ID 200558
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APLF Antibody 100ul

Anti-APLF Antibody 100ul