HS6ST2
  • HS6ST2

Anti-HS6ST2 Antibody 100ul

Ref: AN-HPA034626-100ul
Anti-HS6ST2

Información del producto

Polyclonal Antibody against Human HS6ST2, Gene description: heparan sulfate 6-O-sulfotransferase 2, Validated applications: ICC, WB, Uniprot ID: Q96MM7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HS6ST2
Gene Description heparan sulfate 6-O-sulfotransferase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence CQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQK
Immunogen CQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MM7
HTS Code 3002150000
Gene ID 90161
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HS6ST2 Antibody 100ul

Anti-HS6ST2 Antibody 100ul