FABP2,I-FABP
  • FABP2,I-FABP

Anti-FABP2 Antibody 25ul

Ref: AN-HPA034607-25ul
Anti-FABP2

Información del producto

Polyclonal Antibody against Human FABP2, Gene description: fatty acid binding protein 2, intestinal, Alternative Gene Names: I-FABP, Validated applications: IHC, WB, Uniprot ID: P12104, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FABP2
Gene Description fatty acid binding protein 2, intestinal
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Immunogen LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names I-FABP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P12104
HTS Code 3002150000
Gene ID 2169
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FABP2 Antibody 25ul

Anti-FABP2 Antibody 25ul