PNPT1,DFNB70,old-35
  • PNPT1,DFNB70,old-35

Anti-PNPT1 Antibody 25ul

Ref: AN-HPA034603-25ul
Anti-PNPT1

Información del producto

Polyclonal Antibody against Human PNPT1, Gene description: polyribonucleotide nucleotidyltransferase 1, Alternative Gene Names: DFNB70, old-35, OLD35, PNPase, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TCS8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PNPT1
Gene Description polyribonucleotide nucleotidyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence FSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYPNMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPA
Immunogen FSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYPNMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNB70, old-35, OLD35, PNPase
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TCS8
HTS Code 3002150000
Gene ID 87178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNPT1 Antibody 25ul

Anti-PNPT1 Antibody 25ul