MAN1A2,MAN1B
  • MAN1A2,MAN1B

Anti-MAN1A2 Antibody 100ul

Ref: AN-HPA034559-100ul
Anti-MAN1A2

Información del producto

Polyclonal Antibody against Human MAN1A2, Gene description: mannosidase, alpha, class 1A, member 2, Alternative Gene Names: MAN1B, Validated applications: ICC, IHC, WB, Uniprot ID: O60476, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAN1A2
Gene Description mannosidase, alpha, class 1A, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Immunogen KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MAN1B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60476
HTS Code 3002150000
Gene ID 10905
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAN1A2 Antibody 100ul

Anti-MAN1A2 Antibody 100ul