EFHC2,FLJ22843,MRX74
  • EFHC2,FLJ22843,MRX74

Anti-EFHC2 Antibody 25ul

Ref: AN-HPA034492-25ul
Anti-EFHC2

Información del producto

Polyclonal Antibody against Human EFHC2, Gene description: EF-hand domain (C-terminal) containing 2, Alternative Gene Names: FLJ22843, MRX74, Validated applications: IHC, WB, Uniprot ID: Q5JST6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EFHC2
Gene Description EF-hand domain (C-terminal) containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC
Sequence KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR
Immunogen KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22843, MRX74
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JST6
HTS Code 3002150000
Gene ID 80258
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EFHC2 Antibody 25ul

Anti-EFHC2 Antibody 25ul