SP3,SPR-2
  • SP3,SPR-2

Anti-SP3 Antibody 25ul

Ref: AN-HPA032146-25ul
Anti-SP3

Información del producto

Polyclonal Antibody against Human SP3, Gene description: Sp3 transcription factor, Alternative Gene Names: SPR-2, Validated applications: IHC, Uniprot ID: Q02447, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SP3
Gene Description Sp3 transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQ
Immunogen VQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SPR-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02447
HTS Code 3002150000
Gene ID 6670
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SP3 Antibody 25ul

Anti-SP3 Antibody 25ul