KAZN,FLJ43806
  • KAZN,FLJ43806

Anti-KAZN Antibody 25ul

Ref: AN-HPA032096-25ul
Anti-KAZN

Información del producto

Polyclonal Antibody against Human KAZN, Gene description: kazrin, periplakin interacting protein, Alternative Gene Names: FLJ43806, KAZRIN, KIAA1026, Validated applications: IHC, WB, Uniprot ID: Q674X7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KAZN
Gene Description kazrin, periplakin interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATELRVQLAQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLE
Immunogen RLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATELRVQLAQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ43806, KAZRIN, KIAA1026
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q674X7
HTS Code 3002150000
Gene ID 23254
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KAZN Antibody 25ul

Anti-KAZN Antibody 25ul