KIF17,KIAA1405
  • KIF17,KIAA1405

Anti-KIF17 Antibody 100ul

Ref: AN-HPA032085-100ul
Anti-KIF17

Información del producto

Polyclonal Antibody against Human KIF17, Gene description: kinesin family member 17, Alternative Gene Names: KIAA1405, KIF17B, KIF3X, KLP-2, OSM-3, Validated applications: ICC, IHC, Uniprot ID: Q9P2E2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KIF17
Gene Description kinesin family member 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEP
Immunogen RYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1405, KIF17B, KIF3X, KLP-2, OSM-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2E2
HTS Code 3002150000
Gene ID 57576
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KIF17 Antibody 100ul

Anti-KIF17 Antibody 100ul