TNFRSF8,CD30
  • TNFRSF8,CD30

Anti-TNFRSF8 Antibody 25ul

Ref: AN-HPA032082-25ul
Anti-TNFRSF8

Información del producto

Polyclonal Antibody against Human TNFRSF8, Gene description: tumor necrosis factor receptor superfamily, member 8, Alternative Gene Names: CD30, D1S166E, KI-1, Validated applications: IHC, Uniprot ID: P28908, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TNFRSF8
Gene Description tumor necrosis factor receptor superfamily, member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCP
Immunogen RCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD30, D1S166E, KI-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28908
HTS Code 3002150000
Gene ID 943
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNFRSF8 Antibody 25ul

Anti-TNFRSF8 Antibody 25ul