LCA5L,C21orf13
  • LCA5L,C21orf13

Anti-LCA5L Antibody 25ul

Ref: AN-HPA032010-25ul
Anti-LCA5L

Información del producto

Polyclonal Antibody against Human LCA5L, Gene description: Leber congenital amaurosis 5-like, Alternative Gene Names: C21orf13, MGC33295, Validated applications: IHC, Uniprot ID: O95447, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LCA5L
Gene Description Leber congenital amaurosis 5-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILPFTSMRHQGTQKSDVPPLTTKGKKATGNIDHKEKSTEINHEIPHCVNKLPKQEDSKRKYEDLSGEEKHLEVQILLENT
Immunogen ILPFTSMRHQGTQKSDVPPLTTKGKKATGNIDHKEKSTEINHEIPHCVNKLPKQEDSKRKYEDLSGEEKHLEVQILLENT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf13, MGC33295
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95447
HTS Code 3002150000
Gene ID 150082
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LCA5L Antibody 25ul

Anti-LCA5L Antibody 25ul