KPRP,C1orf45
  • KPRP,C1orf45

Anti-KPRP Antibody 25ul

Ref: AN-HPA031990-25ul
Anti-KPRP

Información del producto

Polyclonal Antibody against Human KPRP, Gene description: keratinocyte proline-rich protein, Alternative Gene Names: C1orf45, Validated applications: IHC, WB, Uniprot ID: Q5T749, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KPRP
Gene Description keratinocyte proline-rich protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence STQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEP
Immunogen STQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf45
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T749
HTS Code 3002150000
Gene ID 448834
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KPRP Antibody 25ul

Anti-KPRP Antibody 25ul