MAGI1,AIP3,BAIAP1
  • MAGI1,AIP3,BAIAP1

Anti-MAGI1 Antibody 100ul

Ref: AN-HPA031852-100ul
Anti-MAGI1

Información del producto

Polyclonal Antibody against Human MAGI1, Gene description: membrane associated guanylate kinase, WW and PDZ domain containing 1, Alternative Gene Names: AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3, Validated applications: ICC, Uniprot ID: Q96QZ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAGI1
Gene Description membrane associated guanylate kinase, WW and PDZ domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Immunogen IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96QZ7
HTS Code 3002150000
Gene ID 9223
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGI1 Antibody 100ul

Anti-MAGI1 Antibody 100ul