Anti-AURKAIP1 Antibody 100ul
  • Anti-AURKAIP1 Antibody 100ul

Anti-AURKAIP1 Antibody 100ul

Ref:  AN-HPA031821-100ul
100ul

Información del producto

Información adicional
Size 100ul
Gene Name AURKAIP1
Gene Description aurora kinase A interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Type Clonality Polyclonal
Immunogen KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AIP, AKIP, FLJ20608
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWT8
HTS Code 3002150000
Gene ID 54998
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AURKAIP1 Antibody 100ul

Anti-AURKAIP1 Antibody 100ul