BCORL1,CXorf10
  • BCORL1,CXorf10

Anti-BCORL1 Antibody 100ul

Ref: AN-HPA031777-100ul
Anti-BCORL1

Información del producto

Polyclonal Antibody against Human BCORL1, Gene description: BCL6 corepressor-like 1, Alternative Gene Names: CXorf10, FLJ11362, Validated applications: IHC, Uniprot ID: Q5H9F3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BCORL1
Gene Description BCL6 corepressor-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Immunogen TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CXorf10, FLJ11362
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5H9F3
HTS Code 3002150000
Gene ID 63035
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BCORL1 Antibody 100ul

Anti-BCORL1 Antibody 100ul