REC8,kleisin-alpha
  • REC8,kleisin-alpha

Anti-REC8 Antibody 25ul

Ref: AN-HPA031729-25ul
Anti-REC8

Información del producto

Polyclonal Antibody against Human REC8, Gene description: REC8 meiotic recombination protein, Alternative Gene Names: kleisin-alpha, REC8L1, Rec8p, Validated applications: IHC, WB, Uniprot ID: O95072, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name REC8
Gene Description REC8 meiotic recombination protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
Immunogen PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names kleisin-alpha, REC8L1, Rec8p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95072
HTS Code 3002150000
Gene ID 9985
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-REC8 Antibody 25ul

Anti-REC8 Antibody 25ul