PMEL,D12S53E,gp100
  • PMEL,D12S53E,gp100

Anti-PMEL Antibody 100ul

Ref: AN-HPA031649-100ul
Anti-PMEL

Información del producto

Polyclonal Antibody against Human PMEL, Gene description: premelanosome protein, Alternative Gene Names: D12S53E, gp100, Pmel17, SI, SIL, SILV, Validated applications: IHC, WB, Uniprot ID: P40967, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PMEL
Gene Description premelanosome protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQGIESAEILQAV
Immunogen PTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQGIESAEILQAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D12S53E, gp100, Pmel17, SI, SIL, SILV
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P40967
HTS Code 3002150000
Gene ID 6490
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PMEL Antibody 100ul

Anti-PMEL Antibody 100ul