PIGH,GPI-H
  • PIGH,GPI-H

Anti-PIGH Antibody 100ul

Ref: AN-HPA031624-100ul
Anti-PIGH

Información del producto

Polyclonal Antibody against Human PIGH, Gene description: phosphatidylinositol glycan anchor biosynthesis, class H, Alternative Gene Names: GPI-H, Validated applications: IHC, WB, Uniprot ID: Q14442, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PIGH
Gene Description phosphatidylinositol glycan anchor biosynthesis, class H
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTS
Immunogen KIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GPI-H
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14442
HTS Code 3002150000
Gene ID 5283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PIGH Antibody 100ul

Anti-PIGH Antibody 100ul