MAGED2,11B6,BCG1
  • MAGED2,11B6,BCG1

Anti-MAGED2 Antibody 25ul

Ref: AN-HPA031573-25ul
Anti-MAGED2

Información del producto

Polyclonal Antibody against Human MAGED2, Gene description: melanoma antigen family D, 2, Alternative Gene Names: 11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UNF1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGED2
Gene Description melanoma antigen family D, 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR
Immunogen LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNF1
HTS Code 3002150000
Gene ID 10916
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGED2 Antibody 25ul

Anti-MAGED2 Antibody 25ul