RP9,PAP-1
  • RP9,PAP-1

Anti-RP9 Antibody 25ul

Ref: AN-HPA031523-25ul
Anti-RP9

Información del producto

Polyclonal Antibody against Human RP9, Gene description: retinitis pigmentosa 9 (autosomal dominant), Alternative Gene Names: PAP-1, Validated applications: ICC, IHC, Uniprot ID: Q8TA86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RP9
Gene Description retinitis pigmentosa 9 (autosomal dominant)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM
Immunogen PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PAP-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TA86
HTS Code 3002150000
Gene ID 6100
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RP9 Antibody 25ul

Anti-RP9 Antibody 25ul