HSCB,DNAJC20,HSC20
  • HSCB,DNAJC20,HSC20

Anti-HSCB Antibody 100ul

Ref: AN-HPA031518-100ul
Anti-HSCB

Información del producto

Polyclonal Antibody against Human HSCB, Gene description: HscB mitochondrial iron-sulfur cluster co-chaperone, Alternative Gene Names: DNAJC20, HSC20, Jac1, Validated applications: ICC, WB, Uniprot ID: Q8IWL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSCB
Gene Description HscB mitochondrial iron-sulfur cluster co-chaperone
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence DCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEM
Immunogen DCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNAJC20, HSC20, Jac1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWL3
HTS Code 3002150000
Gene ID 150274
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HSCB Antibody 100ul

Anti-HSCB Antibody 100ul