SORL1,C11orf32
  • SORL1,C11orf32

Anti-SORL1 Antibody 25ul

Ref: AN-HPA031321-25ul
Anti-SORL1

Información del producto

Polyclonal Antibody against Human SORL1, Gene description: sortilin-related receptor, L(DLR class) A repeats containing, Alternative Gene Names: C11orf32, gp250, LR11, LRP9, SorLA, SorLA-1, Validated applications: IHC, Uniprot ID: Q92673, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SORL1
Gene Description sortilin-related receptor, L(DLR class) A repeats containing
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMS
Immunogen GEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf32, gp250, LR11, LRP9, SorLA, SorLA-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92673
HTS Code 3002150000
Gene ID 6653
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SORL1 Antibody 25ul

Anti-SORL1 Antibody 25ul