ITGA2B,CD41,CD41B
  • ITGA2B,CD41,CD41B

Anti-ITGA2B Antibody 100ul

Ref: AN-HPA031168-100ul
Anti-ITGA2B

Información del producto

Polyclonal Antibody against Human ITGA2B, Gene description: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41), Alternative Gene Names: CD41, CD41B, GP2B, PPP1R93, Validated applications: IHC, Uniprot ID: P08514, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ITGA2B
Gene Description integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Immunogen CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD41, CD41B, GP2B, PPP1R93
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P08514
HTS Code 3002150000
Gene ID 3674
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ITGA2B Antibody 100ul

Anti-ITGA2B Antibody 100ul