ZNF117,H-plk,HPF9
  • ZNF117,H-plk,HPF9

Anti-ZNF117 Antibody 100ul

Ref: AN-HPA031148-100ul
Anti-ZNF117

Información del producto

Polyclonal Antibody against Human ZNF117, Gene description: zinc finger protein 117, Alternative Gene Names: H-plk, HPF9, Validated applications: ICC, Uniprot ID: Q03924, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF117
Gene Description zinc finger protein 117
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CMLSHLTQHKRIQTRVNFYKCEAYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHLIRHKRIHTEEKPYKCEECGKAFNQSSTLTTHNIIHTGEIPYKCEKC
Immunogen CMLSHLTQHKRIQTRVNFYKCEAYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHLIRHKRIHTEEKPYKCEECGKAFNQSSTLTTHNIIHTGEIPYKCEKC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names H-plk, HPF9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q03924
HTS Code 3002150000
Gene ID 51351
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF117 Antibody 100ul

Anti-ZNF117 Antibody 100ul