MCM9,C6orf61
  • MCM9,C6orf61

Anti-MCM9 Antibody 25ul

Ref: AN-HPA031137-25ul
Anti-MCM9

Información del producto

Polyclonal Antibody against Human MCM9, Gene description: minichromosome maintenance complex component 9, Alternative Gene Names: C6orf61, dJ329L24.3, FLJ20170, MCMDC1, MGC35304, Validated applications: ICC, IHC, Uniprot ID: Q9NXL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MCM9
Gene Description minichromosome maintenance complex component 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
Immunogen SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf61, dJ329L24.3, FLJ20170, MCMDC1, MGC35304
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXL9
HTS Code 3002150000
Gene ID 254394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MCM9 Antibody 25ul

Anti-MCM9 Antibody 25ul