ZNF124,HZF-16,HZF16
  • ZNF124,HZF-16,HZF16

Anti-ZNF124 Antibody 100ul

Ref: AN-HPA031127-100ul
Anti-ZNF124

Información del producto

Polyclonal Antibody against Human ZNF124, Gene description: zinc finger protein 124, Alternative Gene Names: HZF-16, HZF16, Validated applications: ICC, IHC, WB, Uniprot ID: Q15973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF124
Gene Description zinc finger protein 124
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRN
Immunogen PCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HZF-16, HZF16
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15973
HTS Code 3002150000
Gene ID 7678
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF124 Antibody 100ul

Anti-ZNF124 Antibody 100ul