OFD1,71-7A,CXorf5
  • OFD1,71-7A,CXorf5

Anti-OFD1 Antibody 100ul

Ref: AN-HPA031103-100ul
Anti-OFD1

Información del producto

Polyclonal Antibody against Human OFD1, Gene description: oral-facial-digital syndrome 1, Alternative Gene Names: 71-7A, CXorf5, JBTS10, RP23, Validated applications: WB, Uniprot ID: O75665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OFD1
Gene Description oral-facial-digital syndrome 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA
Immunogen LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 71-7A, CXorf5, JBTS10, RP23
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75665
HTS Code 3002150000
Gene ID 8481
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OFD1 Antibody 100ul

Anti-OFD1 Antibody 100ul