EIF3M,eIF3m
  • EIF3M,eIF3m

Anti-EIF3M Antibody 100ul

Ref: AN-HPA031063-100ul
Anti-EIF3M

Información del producto

Polyclonal Antibody against Human EIF3M, Gene description: eukaryotic translation initiation factor 3, subunit M, Alternative Gene Names: eIF3m, FLJ29030, GA17, hfl-B5, PCID1, TANGO7, Validated applications: ICC, IHC, WB, Uniprot ID: Q7L2H7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF3M
Gene Description eukaryotic translation initiation factor 3, subunit M
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKS
Immunogen GGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF3m, FLJ29030, GA17, hfl-B5, PCID1, TANGO7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L2H7
HTS Code 3002150000
Gene ID 10480
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF3M Antibody 100ul

Anti-EIF3M Antibody 100ul