MCM4,CDC21,CDC54
  • MCM4,CDC21,CDC54

Anti-MCM4 Antibody 25ul

Ref: AN-HPA031052-25ul
Anti-MCM4

Información del producto

Polyclonal Antibody against Human MCM4, Gene description: minichromosome maintenance complex component 4, Alternative Gene Names: CDC21, CDC54, hCdc21, MGC33310, P1-Cdc21, Validated applications: ICC, WB, Uniprot ID: P33991, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MCM4
Gene Description minichromosome maintenance complex component 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence SSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVG
Immunogen SSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDC21, CDC54, hCdc21, MGC33310, P1-Cdc21
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P33991
HTS Code 3002150000
Gene ID 4173
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MCM4 Antibody 25ul

Anti-MCM4 Antibody 25ul