SLC7A4,CAT-4,HCAT3
  • SLC7A4,CAT-4,HCAT3

Anti-SLC7A4 Antibody 100ul

Ref: AN-HPA031023-100ul
Anti-SLC7A4

Información del producto

Polyclonal Antibody against Human SLC7A4, Gene description: solute carrier family 7, member 4, Alternative Gene Names: CAT-4, HCAT3, VH, Validated applications: IHC, WB, Uniprot ID: O43246, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC7A4
Gene Description solute carrier family 7, member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
Immunogen GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAT-4, HCAT3, VH
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43246
HTS Code 3002150000
Gene ID 6545
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC7A4 Antibody 100ul

Anti-SLC7A4 Antibody 100ul