GALNTL6,GalNAc-T6L
  • GALNTL6,GalNAc-T6L

Anti-GALNTL6 Antibody 100ul

Ref: AN-HPA031019-100ul
Anti-GALNTL6

Información del producto

Polyclonal Antibody against Human GALNTL6, Gene description: polypeptide N-acetylgalactosaminyltransferase-like 6, Alternative Gene Names: GalNAc-T6L, GALNT17, Validated applications: IHC, WB, Uniprot ID: Q49A17, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GALNTL6
Gene Description polypeptide N-acetylgalactosaminyltransferase-like 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
Immunogen DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T6L, GALNT17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q49A17
HTS Code 3002150000
Gene ID 442117
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNTL6 Antibody 100ul

Anti-GALNTL6 Antibody 100ul