SH3YL1
  • SH3YL1

Anti-SH3YL1 Antibody 25ul

Ref: AN-HPA030926-25ul
Anti-SH3YL1

Información del producto

Polyclonal Antibody against Human SH3YL1, Gene description: SH3 and SYLF domain containing 1, Alternative Gene Names: DKFZP586F1318, Ray, Validated applications: IHC, WB, Uniprot ID: Q96HL8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SH3YL1
Gene Description SH3 and SYLF domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Immunogen FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586F1318, Ray
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HL8
HTS Code 3002150000
Gene ID 26751
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SH3YL1 Antibody 25ul

Anti-SH3YL1 Antibody 25ul