SARNP,CIP29,Hcc-1
  • SARNP,CIP29,Hcc-1

Anti-SARNP Antibody 100ul

Ref: AN-HPA030902-100ul
Anti-SARNP

Información del producto

Polyclonal Antibody against Human SARNP, Gene description: SAP domain containing ribonucleoprotein, Alternative Gene Names: CIP29, Hcc-1, THO1, Validated applications: ICC, IHC, WB, Uniprot ID: P82979, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SARNP
Gene Description SAP domain containing ribonucleoprotein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Immunogen SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIP29, Hcc-1, THO1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82979
HTS Code 3002150000
Gene ID 84324
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SARNP Antibody 100ul

Anti-SARNP Antibody 100ul