ARMC12,C6orf81
  • ARMC12,C6orf81

Anti-ARMC12 Antibody 100ul

Ref: AN-HPA030895-100ul
Anti-ARMC12

Información del producto

Polyclonal Antibody against Human ARMC12, Gene description: armadillo repeat containing 12, Alternative Gene Names: C6orf81, FLJ25390, Validated applications: ICC, WB, Uniprot ID: Q5T9G4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARMC12
Gene Description armadillo repeat containing 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence YEVLVFAERLSEGRNAPHYHVVKWHYNEQSLHESLFGEESRLADRLLALVIHPEEDVQIQACKVIVSLQYPQDL
Immunogen YEVLVFAERLSEGRNAPHYHVVKWHYNEQSLHESLFGEESRLADRLLALVIHPEEDVQIQACKVIVSLQYPQDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf81, FLJ25390
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T9G4
HTS Code 3002150000
Gene ID 221481
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARMC12 Antibody 100ul

Anti-ARMC12 Antibody 100ul