SRC,ASV,c-src,SRC1
  • SRC,ASV,c-src,SRC1

Anti-SRC Antibody 25ul

Ref: AN-HPA030875-25ul
Anti-SRC

Información del producto

Polyclonal Antibody against Human SRC, Gene description: SRC proto-oncogene, non-receptor tyrosine kinase, Alternative Gene Names: ASV, c-src, SRC1, Validated applications: ICC, WB, Uniprot ID: P12931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SRC
Gene Description SRC proto-oncogene, non-receptor tyrosine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
Immunogen MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASV, c-src, SRC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P12931
HTS Code 3002150000
Gene ID 6714
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SRC Antibody 25ul

Anti-SRC Antibody 25ul