SH3BGR,21-GARP
  • SH3BGR,21-GARP

Anti-SH3BGR Antibody 100ul

Ref: AN-HPA030690-100ul
Anti-SH3BGR

Información del producto

Polyclonal Antibody against Human SH3BGR, Gene description: SH3 domain binding glutamate-rich protein, Alternative Gene Names: 21-GARP, Validated applications: IHC, Uniprot ID: P55822, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SH3BGR
Gene Description SH3 domain binding glutamate-rich protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVL
Immunogen MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 21-GARP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55822
HTS Code 3002150000
Gene ID 6450
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SH3BGR Antibody 100ul

Anti-SH3BGR Antibody 100ul