TMEM63C,C14orf171
  • TMEM63C,C14orf171

Anti-TMEM63C Antibody 25ul

Ref: AN-HPA030657-25ul
Anti-TMEM63C

Información del producto

Polyclonal Antibody against Human TMEM63C, Gene description: transmembrane protein 63C, Alternative Gene Names: C14orf171, CSC1, DKFZp434P0111, hsCSC1, Validated applications: ICC, IHC, Uniprot ID: Q9P1W3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TMEM63C
Gene Description transmembrane protein 63C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYTAKAKKTGKVMIRIHPCARLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDSRMAKRVRKDYKYVQCGVQPQQSSVTTIVKSYYWRVTMA
Immunogen GSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYTAKAKKTGKVMIRIHPCARLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDSRMAKRVRKDYKYVQCGVQPQQSSVTTIVKSYYWRVTMA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf171, CSC1, DKFZp434P0111, hsCSC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P1W3
HTS Code 3002150000
Gene ID 57156
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM63C Antibody 25ul

Anti-TMEM63C Antibody 25ul