SYTL3,exophilin-6
  • SYTL3,exophilin-6

Anti-SYTL3 Antibody 100ul

Ref: AN-HPA030586-100ul
Anti-SYTL3

Información del producto

Polyclonal Antibody against Human SYTL3, Gene description: synaptotagmin-like 3, Alternative Gene Names: exophilin-6, SLP3, Validated applications: ICC, IHC, Uniprot ID: Q4VX76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SYTL3
Gene Description synaptotagmin-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCL
Immunogen TWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names exophilin-6, SLP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4VX76
HTS Code 3002150000
Gene ID 94120
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SYTL3 Antibody 100ul

Anti-SYTL3 Antibody 100ul