SRBD1,FLJ10379
  • SRBD1,FLJ10379

Anti-SRBD1 Antibody 25ul

Ref: AN-HPA030567-25ul
Anti-SRBD1

Información del producto

Polyclonal Antibody against Human SRBD1, Gene description: S1 RNA binding domain 1, Alternative Gene Names: FLJ10379, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N5C6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SRBD1
Gene Description S1 RNA binding domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence LDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDF
Immunogen LDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10379
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5C6
HTS Code 3002150000
Gene ID 55133
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SRBD1 Antibody 25ul

Anti-SRBD1 Antibody 25ul