LRP5,BMND1,EVR1
  • LRP5,BMND1,EVR1

Anti-LRP5 Antibody 100ul

Ref: AN-HPA030505-100ul
Anti-LRP5

Información del producto

Polyclonal Antibody against Human LRP5, Gene description: low density lipoprotein receptor-related protein 5, Alternative Gene Names: BMND1, EVR1, EVR4, HBM, LR3, LRP7, OPPG, OPS, OPTA1, VBCH2, Validated applications: IHC, Uniprot ID: O75197, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRP5
Gene Description low density lipoprotein receptor-related protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYII
Immunogen VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BMND1, EVR1, EVR4, HBM, LR3, LRP7, OPPG, OPS, OPTA1, VBCH2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75197
HTS Code 3002150000
Gene ID 4041
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRP5 Antibody 100ul

Anti-LRP5 Antibody 100ul