LGALS8,PCTA-1
  • LGALS8,PCTA-1

Anti-LGALS8 Antibody 25ul

Ref: AN-HPA030491-25ul
Anti-LGALS8

Información del producto

Polyclonal Antibody against Human LGALS8, Gene description: lectin, galactoside-binding, soluble, 8, Alternative Gene Names: PCTA-1, Validated applications: IHC, WB, Uniprot ID: O00214, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LGALS8
Gene Description lectin, galactoside-binding, soluble, 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS
Immunogen PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCTA-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00214
HTS Code 3002150000
Gene ID 3964
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LGALS8 Antibody 25ul

Anti-LGALS8 Antibody 25ul