TRMT11,C6orf75
  • TRMT11,C6orf75

Anti-TRMT11 Antibody 25ul

Ref: AN-HPA030473-25ul
Anti-TRMT11

Información del producto

Polyclonal Antibody against Human TRMT11, Gene description: tRNA methyltransferase 11 homolog, Alternative Gene Names: C6orf75, dJ187J11.2, MDS024, TRM11, TRMT11-1, Validated applications: ICC, Uniprot ID: Q7Z4G4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRMT11
Gene Description tRNA methyltransferase 11 homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG
Immunogen FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf75, dJ187J11.2, MDS024, TRM11, TRMT11-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4G4
HTS Code 3002150000
Gene ID 60487
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRMT11 Antibody 25ul

Anti-TRMT11 Antibody 25ul