RPL26,L26
  • RPL26,L26

Anti-RPL26 Antibody 100ul

Ref: AN-HPA030449-100ul
Anti-RPL26

Información del producto

Polyclonal Antibody against Human RPL26, Gene description: ribosomal protein L26, Alternative Gene Names: L26, Validated applications: ICC, IHC, WB, Uniprot ID: P61254, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPL26
Gene Description ribosomal protein L26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV
Immunogen NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L26
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61254
HTS Code 3002150000
Gene ID 6154
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPL26 Antibody 100ul

Anti-RPL26 Antibody 100ul